
FOXO4-DRI
Also known as: FOXO4 D-Retro-Inverso peptide, Proxofim
- Purity
- Batch-specific
- Form
- Lyophilized powder
- Enquiry Sizes
- Research vial • Bulk / custom fill (quote required)
- Peptide Sequence
- D-amino-acid retro-inverso of LTLRKEPASEIAQSILEAYSQNGWANRRSGGK fused to a cell-penetrating import motif
Compliance Notice: All products supplied by BioTech Pharma are intended strictly for laboratory research and development use only. They are not intended for human or veterinary use, diagnosis, treatment, or consumption of any kind. By submitting an enquiry, the requester confirms they are a qualified researcher or institution and accepts full responsibility for compliant handling and use.
Configure Your Request
Documentation requests are reviewed against the records available for the applicable lot. Availability, methods, and values must be confirmed for the specific enquiry and are not promised in advance.
Form supplied: Lyophilized powder. Your selections are carried into the quote request automatically.
Overview
FOXO4-DRI is an all-D-amino-acid, retro-inverso peptide derived from a segment of the transcription factor Forkhead box O4 (FOXO4), fused to a cell-penetrating import motif. It was described by de Keizer and colleagues as a tool for disrupting the FOXO4–p53 interaction that sequesters p53 in the nuclei of senescent cells.
The retro-inverso design — reversed sequence assembled from D-amino acids — is used to improve proteolytic stability relative to the native L-peptide while preserving the intended interaction surface. The published construct is the reference identity for this catalog entry; lot-specific analytical documentation may be available and should be confirmed for the applicable material.
Reported effects on senescent-cell viability come from in-vitro and rodent preclinical studies and represent exploratory research findings, not established pharmacology. BioTech Pharma supplies the peptide solely as a research reagent for senescence and senolytic-mechanism investigation.
Research Applications
- Cellular senescence and senolytic-mechanism studies
- FOXO4–p53 protein-interaction research
- Retro-inverso peptide stability and design work
- Cell-penetrating peptide delivery studies
- p53 nuclear-localization and apoptosis assays
Frequently Asked Questions
Scientific References
Analytical Data
Lot-specific documentation may be available for the applicable material and must be confirmed per enquiry. Where available, it may include:
- HPLC purity result
- LC-MS identity confirmation
- Appearance
- Net content
Request the records you need with your quote and we will confirm availability for your batch.
Procurement Details
Availability, lead time, salt / content basis, and cold-chain requirements depend on the specific lot and quantity, so we confirm them per enquiry rather than publishing fixed figures. Request confirmation for your requirements with your quote and our team will respond with details for the applicable batch.
Storage & Handling
Lyophilized powder: store desiccated at −20 °C, protected from light and moisture. Reconstitute immediately before use; keep prepared aqueous solutions cold (2–8 °C) and use within an empirically determined stability window for the applicable material.
Related Compounds

Epithalon
Synthetic tetrapeptide (Ala-Glu-Asp-Gly) modeled on pineal epithalamin, studied in telomerase and aging-biology research.

NAD+
The universal redox coenzyme — foundational to cellular-energy, sirtuin, and aging-biology research.

Bacteriostatic Water
Aqueous laboratory research reagent studied as a companion diluent for reconstituting lyophilized peptides in the laboratory.
